General Information

  • ID:  hor005648
  • Uniprot ID:  O09210
  • Protein name:  Bombyxin-related peptide B chain A
  • Gene name:  NA
  • Organism:  Agrius convolvuli (Convolvulus hawk-moth)
  • Family:  insulin family
  • Source:  Animal
  • Expression:  Located in 4 pairs of medial neurosecretory cells in the brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Agrius (genus), Acherontiini (tribe), Sphinginae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008083 growth factor activity; GO:0018445 prothoracicotrophic hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  GVVEECCYQSCTLDELLTYC
  • Length:  20(74-93)
  • Propeptide:  MKFVLVLVSLALLVSLASVQGNNYCGRHLSETLAYMCPELEGASKRSGAMGAAAMYGTRGWRWAAMGGNRGKRGVVEECCYQSCTLDELLTYC
  • Signal peptide:  MKFVLVLVSLALLVSLASVQG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45819
  • Structure ID:  AF-O09210-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005648_AF2.pdbhor005648_ESM.pdb

Physical Information

Mass: 261067 Formula: C95H147N21O35S4
Absent amino acids: AFHIKMNPRW Common amino acids: C
pI: 3.33 Basic residues: 0
Polar residues: 10 Hydrophobic residues: 5
Hydrophobicity: 35.5 Boman Index: -1461
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 87.5
Instability Index: 10234 Extinction Coefficient cystines: 3230
Absorbance 280nm: 170

Literature

  • PubMed ID:  8673077
  • Title:  Bombyxin-related peptides: cDNA structure and expression in the brain of the hornworm Agrius convolvuli [corrected]